PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan016194
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family SRS
Protein Properties Length: 323aa    MW: 34434.7 Da    PI: 8.633
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-16160994PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702210.83.4e-651082654154
     DUF702   4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskkelets 103
                 t +CqdCGnqakkdC+h+RCRtCCksrg+dCathvkstWvpaa+rrerq ++ +    a+ s+a++  k++r +  ++++++s+t+ s+++++++ +ts
  Aan016194 108 STLTCQDCGNQAKKDCTHRRCRTCCKSRGYDCATHVKSTWVPAARRRERQLMTPTG--AATVSSATSGLKKPRLT--SHTTTTSHTSNSNTTPPRSYDTS 203
                5679********************************************97666554..55556677778888865..88888889999999999999999 PP

     DUF702 104 s...........lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                s           lP++v+++avf+cvrv++vddg++e+aYq++ +igGhvfkG+LydqG+e+
  Aan016194 204 SshhqdasfkesLPRQVRAPAVFKCVRVTAVDDGDDEYAYQASTTIGGHVFKGFLYDQGVET 265
                889999999999***********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.5E-60109264IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016234.3E-27111153IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.3E-27216263IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
GLRDVFVVAD PHGHPHSITN AGAATALGRS VGVGVIPLLS TTPCLEEDML NSRGRGNNNS  60
NSSTNNYSIQ FWQQHPQTQP HNYLNKPMIS DHGFLQASVG GSSSTSGSTL TCQDCGNQAK  120
KDCTHRRCRT CCKSRGYDCA THVKSTWVPA ARRRERQLMT PTGAATVSSA TSGLKKPRLT  180
SHTTTTSHTS NSNTTPPRSY DTSSSHHQDA SFKESLPRQV RAPAVFKCVR VTAVDDGDDE  240
YAYQASTTIG GHVFKGFLYD QGVETRDQNS FPNFSELHLG GNNSSGGGRN VGGSTSSPLY  300
PSDVYASSGG GLITGSNYGN TIN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010651514.11e-107PREDICTED: protein LATERAL ROOT PRIMORDIUM 1, partial
SwissprotQ94CK94e-74LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLA0A118K4X71e-148A0A118K4X7_CYNCS; Lateral Root Primordium type 1, C-terminal
STRINGVIT_06s0009g03450.t011e-107(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.29e-66Lateral root primordium (LRP) protein-related